PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG495700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 199aa    MW: 23049.3 Da    PI: 6.355
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG495700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS167.21.3e-512188187373
                 GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                          e+++ e+L+++p+E+l+Vn+++q ++l+d+sv +es+rd  L+ +++++P+ +++   + + +++ F++rf eal yysalfd l+++ p
  Pavir.3KG495700.1.p   2 ETIRAEDLNLDPEEVLIVNCIYQFKNLMDDSVLIESPRDVALNNIRKMRPHAFIHGIVNGSFSAPFFVTRFREALFYYSALFDVLDTTTP 91 
                          78899************************************************************************************* PP

                 GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                          r+s++r+ +E+ ++gr++ nv+aceg++r+er et+++W+ r ++aG+k++pl+ ++++ ++  +++++ + + ++ ++++l++gWk+r 
  Pavir.3KG495700.1.p  92 RDSNQRMLIEQNIFGRAALNVIACEGTDRVERPETYKQWQVRNQRAGLKQLPLNPNIVQVVRDKVKECYHKDFVIDIDHHWLLQGWKGRI 181
                          *********************************************************************889****************** PP

                 GRAS 367 LvsvSaW 373
                          L+++S W
  Pavir.3KG495700.1.p 182 LFAISTW 188
                          ******* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098527.7531169IPR005202Transcription factor GRAS
PfamPF035144.5E-492188IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
METIRAEDLN LDPEEVLIVN CIYQFKNLMD DSVLIESPRD VALNNIRKMR PHAFIHGIVN  60
GSFSAPFFVT RFREALFYYS ALFDVLDTTT PRDSNQRMLI EQNIFGRAAL NVIACEGTDR  120
VERPETYKQW QVRNQRAGLK QLPLNPNIVQ VVRDKVKECY HKDFVIDIDH HWLLQGWKGR  180
ILFAISTWVA NDDAGSYF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-168188194374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.250040.0callus| leaf| root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660358.11e-138PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 9
SwissprotO809338e-76SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A0Q3SAL11e-140A0A0Q3SAL1_SETIT; Uncharacterized protein (Fragment)
TrEMBLK3ZD861e-139K3ZD86_SETIT; Uncharacterized protein
STRINGSi024520m1e-138(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2228967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.15e-77GRAS family protein